PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05079.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Whirly
Protein Properties Length: 156aa    MW: 17355.6 Da    PI: 12.038
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05079.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly32.51.5e-1063962154
                          Whirly 21 ldsgnlklkraGglllelanataerkydWekkqs 54
                                      sg ++++r+G+++l++ +a+++rkyd++kkq+
  Zmw_sc05079.1.g00060.1.sm.mkhc 63 AHSGGFRVSRNGSVMLTFFPAIGQRKYDYSKKQK 96
                                    56999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.0E-96296IPR009044ssDNA-binding transcriptional regulator
PfamPF085363.2E-96296IPR013742Plant transcription factor
SuperFamilySSF544479.42E-2364156IPR009044ssDNA-binding transcriptional regulator
Gene3DG3DSA:2.30.31.103.5E-1297137IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MLRLSRFLPS ASRSATTISP NPTSPHFPSR SGQSAAGGRV SRRSAAQFFY SLGANQLFGR  60
ERAHSGGFRV SRNGSVMLTF FPAIGQRKYD YSKKQKTTDR VSVPITKGEF AALRTALSFA  120
LPHIMGWDQV LTNHHPAPQG SKPRMERPHP DSEWER
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002453336.16e-33hypothetical protein SORBIDRAFT_04g004060
TrEMBLM7ZQD65e-35M7ZQD6_TRIUA; Uncharacterized protein
STRINGSb04g004060.12e-32(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30123885